NDUFS6 (NM_004553) Human Mass Spec Standard
CAT#: PH307108
NDUFS6 MS Standard C13 and N15-labeled recombinant protein (NP_004544)
View other "NDUFS6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NDUFS6 MS Standard C13 and N15-labeled recombinant protein (NP_004544) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207108 |
Predicted MW | 13.7 kDa |
Protein Sequence |
>RC207108 protein sequence
Red=Cloning site Green=Tags(s) MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAID LIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004544 |
RefSeq Size | 554 |
RefSeq ORF | 372 |
Synonyms | CI-13kA; CI-13kD-A; CI13KDA; MC1DN9 |
Locus ID | 4726 |
Cytogenetics | 5p15.33 |
Summary | This gene encodes a subunit of the NADH:ubiquinone oxidoreductase (complex I), which is the first enzyme complex in the electron transport chain of mitochondria. This complex functions in the transfer of electrons from NADH to the respiratory chain. The subunit encoded by this gene is one of seven subunits in the iron-sulfur protein fraction. Mutations in this gene cause mitochondrial complex I deficiency, a disease that causes a wide variety of clinical disorders, including neonatal disease and adult-onset neurodegenerative disorders.[provided by RefSeq, Oct 2009] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417910 | NDUFS6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417910 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) (NDUFS6), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP307108 | Recombinant protein of human NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) (NDUFS6), 20 µg |
CNY 2,900.00 |