LILRA3 (NM_006865) Human Mass Spec Standard
CAT#: PH307003
LILRA3 MS Standard C13 and N15-labeled recombinant protein (NP_006856)
View other "LILRA3" proteins (6)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | LILRA3 MS Standard C13 and N15-labeled recombinant protein (NP_006856) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207003 |
Predicted MW | 47.5 kDa |
Protein Sequence |
>RC207003 protein sequence
Red=Cloning site Green=Tags(s) MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWI TRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGN VTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSL PSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQA NFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQG GMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS GAAETLSPPQNKSDSKAGE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006856 |
RefSeq Size | 1608 |
RefSeq ORF | 1317 |
Synonyms | CD85E; HM31; HM43; ILT-6; ILT6; LIR-4; LIR4 |
Locus ID | 11026 |
Cytogenetics | 19q13.4 |
Summary | This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416372 | LILRA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC432960 | LILRA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416372 | Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3) |
CN¥ 3,080.00 |
|
LY432960 | Transient overexpression lysate of leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), transcript variant 2 |
CN¥ 3,080.00 |
|
TP307003 | Recombinant protein of human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), 20 µg |
CN¥ 2,900.00 |
|
TP721110 | Purified recombinant protein of Human leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 (LILRA3), transcript variant 1 |
CN¥ 1,800.00 |