CD94 (KLRD1) (NM_002262) Human Mass Spec Standard
CAT#: PH306991
KLRD1 MS Standard C13 and N15-labeled recombinant protein (NP_002253)
View other "CD94" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | KLRD1 MS Standard C13 and N15-labeled recombinant protein (NP_002253) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206991 |
Predicted MW | 20.5 kDa |
Protein Sequence |
>RC206991 protein sequence
Red=Cloning site Green=Tags(s) MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRC NCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYL FPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002253 |
RefSeq Size | 3258 |
RefSeq ORF | 537 |
Synonyms | CD94 |
Locus ID | 3824 |
Cytogenetics | 12p13.2 |
Summary | Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2017] |
Protein Families | Transmembrane |
Protein Pathways | Antigen processing and presentation, Graft-versus-host disease, Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416035 | KLRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419442 | KLRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426488 | KLRD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416035 | Transient overexpression lysate of killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 2 |
CNY 3,080.00 |
|
LY419442 | Transient overexpression lysate of killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1 |
CNY 3,080.00 |
|
LY426488 | Transient overexpression lysate of killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 3 |
CNY 3,080.00 |
|
TP306991 | Recombinant protein of human killer cell lectin-like receptor subfamily D, member 1 (KLRD1), transcript variant 1, 20 µg |
CNY 2,900.00 |