United States
Germany
Japan
United Kingdom
China
RBFOX2 (NM_001031695) Human Mass Spec Standard
CAT＃: PH306846
RBM9 MS Standard C13 and N15-labeled recombinant protein (NP_001026865)
View other "RBFOX2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | RBM9 MS Standard C13 and N15-labeled recombinant protein (NP_001026865) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206846 |
| Predicted MW | 40.4 kDa |
| Protein Sequence |
>RC206846 protein sequence
Red=Cloning site Green=Tags(s) MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE QSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV EIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVG AVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGR TVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD PYHALAPAASYGVGAVASLYRGGYSRFAPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001026865 |
| RefSeq Size | 6997 |
| RefSeq ORF | 1140 |
| Synonyms | dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA |
| Locus ID | 23543 |
| Cytogenetics | 22q12.3 |
| Summary | This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415365 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421191 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421192 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421906 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415365 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 2 |
CNY 3,080.00 |
|
| LY421191 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 3 |
CNY 3,080.00 |
|
| LY421192 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 4 |
CNY 3,080.00 |
|
| LY421906 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 1 |
CNY 3,080.00 |
|
| TP306846 | Purified recombinant protein of Homo sapiens RNA binding motif protein 9 (RBM9), transcript variant 1, 20 µg |
CNY 2,900.00 |
