GCAP1 (GUCA1A) (NM_000409) Human Mass Spec Standard
CAT#: PH306595
GUCA1A MS Standard C13 and N15-labeled recombinant protein (NP_000400)
View other "GCAP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | GUCA1A MS Standard C13 and N15-labeled recombinant protein (NP_000400) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206595 |
Predicted MW | 22.9 kDa |
Protein Sequence |
>RC206595 protein sequence
Red=Cloning site Green=Tags(s) MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVF SKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000400 |
RefSeq Size | 1918 |
RefSeq ORF | 603 |
Synonyms | GUCA1A; GUCA1ANB-GUCA1A |
Locus ID | 2978 |
Cytogenetics | 6p21.1 |
Summary | This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome |
Protein Pathways | Olfactory transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424724 | GUCA1A HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424724 | Transient overexpression lysate of guanylate cyclase activator 1A (retina) (GUCA1A) |
CN¥ 3,080.00 |
|
TP306595 | Recombinant protein of human guanylate cyclase activator 1A (retina) (GUCA1A), 20 µg |
CN¥ 2,900.00 |