MAPK11 (NM_002751) Human Mass Spec Standard
CAT#: PH306583
MAPK11 MS Standard C13 and N15-labeled recombinant protein (NP_002742)
View other "MAPK11" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MAPK11 MS Standard C13 and N15-labeled recombinant protein (NP_002742) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206583 |
Predicted MW | 41.4 kDa |
Protein Sequence |
>RC206583 protein sequence
Red=Cloning site Green=Tags(s) MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYR ELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKY IHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG CIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPL AIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKP PEPPKPPGSLEIEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002742 |
RefSeq Size | 2463 |
RefSeq ORF | 1092 |
Synonyms | p38-2; P38B; p38Beta; P38BETA2; PRKM11; SAPK2; SAPK2B |
Locus ID | 5600 |
Cytogenetics | 22q13.33 |
Summary | This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400971 | MAPK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400971 | Transient overexpression lysate of mitogen-activated protein kinase 11 (MAPK11) |
CNY 3,080.00 |
|
TP306583 | Recombinant protein of human mitogen-activated protein kinase 11 (MAPK11), 20 µg |
CNY 2,900.00 |