Protein C (PROC) (NM_000312) Human Mass Spec Standard
CAT#: PH306582
PROC MS Standard C13 and N15-labeled recombinant protein (NP_000303)
View other "Protein C" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 3 publications. |
Specifications
Product Data | |
Description | PROC MS Standard C13 and N15-labeled recombinant protein (NP_000303) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206582 |
Predicted MW | 52.1 kDa |
Protein Sequence |
>RC206582 protein sequence
Red=Cloning site Green=Tags(s) MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAK EIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFCQREVSFLNC SLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDP RLIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDL DIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREK EAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000303 |
RefSeq Size | 1790 |
RefSeq ORF | 1383 |
Synonyms | APC; PC; PROC1; THPH3; THPH4 |
Locus ID | 5624 |
Cytogenetics | 2q14.3 |
Summary | This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Complement and coagulation cascades |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Neurofascin IgG4 antibodies in CIDP associate with disabling tremor and poor response to IVIg
,null,
Neurology
,PubMed ID 24523485
[PROC]
|
A Phosphomimetic Mutation at Threonine-57 Abolishes Transactivation Activity and Alters Nuclear Localization Pattern of Human Pregnane X Receptor
,null,
Drug Metabolism and Disposition
,PubMed ID 19171678
[PROC]
|
Ephrin-B2 ligand is a functional receptor for Hendra virus and Nipah virus
,null,
,PubMed ID 15998730
[PROC]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400117 | PROC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400117 | Transient overexpression lysate of protein C (inactivator of coagulation factors Va and VIIIa) (PROC) |
CNY 3,080.00 |
|
TP306582 | Recombinant protein of human protein C (inactivator of coagulation factors Va and VIIIa) (PROC), 20 µg |
CNY 2,900.00 |
其它Protein C产品