United States
Germany
Japan
United Kingdom
China
Myosin (MYL4) (NM_001002841) Human Mass Spec Standard
CAT＃: PH306569
MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_001002841)
View other "Myosin" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_001002841) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206569 |
| Predicted MW | 21.6 kDa |
| Protein Sequence |
>RC206569 protein sequence
Red=Cloning site Green=Tags(s) MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001002841 |
| RefSeq Size | 934 |
| RefSeq ORF | 591 |
| Synonyms | ALC1; AMLC; GT1; PRO1957 |
| Locus ID | 4635 |
| Cytogenetics | 17q21.32 |
| Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419311 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424166 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425089 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419311 | Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2 |
CNY 3,080.00 |
|
| LY424166 | Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1 |
CNY 3,080.00 |
|
| PH313170 | MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_002467) |
CNY 19,520.00 |
|
| TP306569 | Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP313170 | Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2, 20 µg |
CNY 2,900.00 |
