ARSB (NM_198709) Human Mass Spec Standard
CAT#: PH306565
ARSB MS Standard C13 and N15-labeled recombinant protein (NP_942002)
View other "ARSB" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ARSB MS Standard C13 and N15-labeled recombinant protein (NP_942002) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206565 |
Predicted MW | 46 kDa |
Protein Sequence |
>RC206565 protein sequence
Red=Cloning site Green=Tags(s) MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPYWPECSLLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_942002 |
RefSeq Size | 2172 |
RefSeq ORF | 1239 |
Synonyms | ASB; G4S; MPS6 |
Locus ID | 411 |
Cytogenetics | 5q14.1 |
Summary | Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400011 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC404825 | ARSB HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400011 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 1 |
CN¥ 4,840.00 |
|
LY404825 | Transient overexpression lysate of arylsulfatase B (ARSB), transcript variant 2 |
CN¥ 3,080.00 |
|
PH314604 | ARSB MS Standard C13 and N15-labeled recombinant protein (NP_000037) |
CN¥ 19,520.00 |
|
TP306565 | Recombinant protein of human arylsulfatase B (ARSB), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP314604 | Recombinant protein of human arylsulfatase B (ARSB), transcript variant 1, 20 µg |
CN¥ 2,900.00 |