ROR gamma (RORC) (NM_005060) Human Mass Spec Standard
CAT#: PH306541
RORC MS Standard C13 and N15-labeled recombinant protein (NP_005051)
View other "ROR gamma" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | RORC MS Standard C13 and N15-labeled recombinant protein (NP_005051) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206541 |
Predicted MW | 58.2 kDa |
Protein Sequence |
>RC206541 protein sequence
Red=Cloning site Green=Tags(s) MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQ QNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAG AQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGK AEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKS YRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQI VLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLH PIVVQAAFPPLYKELFSTETESPVGLSK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005051 |
RefSeq Size | 3084 |
RefSeq ORF | 1554 |
Synonyms | IMD42; NR1F3; RORG; RZR-GAMMA; RZRG; TOR |
Locus ID | 6097 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401568 | RORC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424370 | RORC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401568 | Transient overexpression lysate of RAR-related orphan receptor C (RORC), transcript variant 1 |
CNY 3,080.00 |
|
LY424370 | Transient overexpression lysate of RAR-related orphan receptor C (RORC), transcript variant 2 |
CNY 4,840.00 |
|
TP306541 | Recombinant protein of human RAR-related orphan receptor C (RORC), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它ROR gamma产品