Carbonic Anhydrase XIV (CA14) (NM_012113) Human Mass Spec Standard
CAT#: PH306503
CA14 MS Standard C13 and N15-labeled recombinant protein (NP_036245)
View other "Carbonic Anhydrase XIV" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CA14 MS Standard C13 and N15-labeled recombinant protein (NP_036245) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206503 |
Predicted MW | 37.7 kDa |
Protein Sequence |
>RC206503 protein sequence
Red=Cloning site Green=Tags(s) MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036245 |
RefSeq Size | 1757 |
RefSeq ORF | 1011 |
Synonyms | CAXiV |
Locus ID | 23632 |
Cytogenetics | 1q21.2 |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XIV is predicted to be a type I membrane protein and shares highest sequence similarity with the other transmembrane CA isoform, CA XII; however, they have different patterns of tissue-specific expression and thus may play different physiologic roles. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415966 | CA14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415966 | Transient overexpression lysate of carbonic anhydrase XIV (CA14) |
CNY 3,080.00 |
|
TP306503 | Recombinant protein of human carbonic anhydrase XIV (CA14), 20 µg |
CNY 2,900.00 |
|
TP720955 | Purified recombinant protein of Human carbonic anhydrase XIV (CA14) |
CNY 3,140.00 |
其它Carbonic Anhydrase XIV产品