CD4 (NM_000616) Human Mass Spec Standard
CAT#: PH306453
CD4 MS Standard C13 and N15-labeled recombinant protein (NP_000607)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CD4 MS Standard C13 and N15-labeled recombinant protein (NP_000607) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206453 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC206453 protein sequence
Red=Cloning site Green=Tags(s) MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLT KGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLT LTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSI VYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPL HLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAK VSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000607 |
RefSeq Size | 3134 |
RefSeq ORF | 1374 |
Synonyms | CD4mut; IMD79; OKT4D |
Locus ID | 920 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes the CD4 membrane glycoprotein of T lymphocytes. The CD4 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class II MHC molecules. The CD4 antigen is also a primary receptor for entry of the human immunodeficiency virus through interactions with the HIV Env gp120 subunit. This gene is expressed not only in T lymphocytes, but also in B cells, macrophages, granulocytes, as well as in various regions of the brain. The protein functions to initiate or augment the early phase of T-cell activation, and may function as an important mediator of indirect neuronal damage in infectious and immune-mediated diseases of the central nervous system. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, May 2020] |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transmembrane |
Protein Pathways | Antigen processing and presentation, Cell adhesion molecules (CAMs), Hematopoietic cell lineage, Primary immunodeficiency, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400209 | CD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434120 | CD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400209 | Transient overexpression lysate of CD4 molecule (CD4) |
CNY 3,080.00 |
|
LY434120 | Transient overexpression lysate of CD4 molecule (CD4), transcript variant 2 |
CNY 3,080.00 |
|
TP306453 | Recombinant protein of human CD4 molecule (CD4), 20 µg |
CNY 2,900.00 |