United States
Germany
Japan
United Kingdom
China
CD16 (FCGR3A) (NM_000569) Human Mass Spec Standard
CAT＃: PH306429
FCGR3A MS Standard C13 and N15-labeled recombinant protein (NP_000560)
View other "CD16" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 3,600.00
Specifications
| Product Data | |
| Description | FCGR3A MS Standard C13 and N15-labeled recombinant protein (NP_000560) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206429 |
| Predicted MW | 32.64 kDa |
| Protein Sequence |
>RC206429 representing NM_000569
Red=Cloning site Green=Tags(s) MGGGAGERLFTSSCLVGLVPLGLRISLVTCPLQCGIMWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQW YRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEV HIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRG LVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHK FKWRKDPQDK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000560 |
| RefSeq Size | 2406 |
| RefSeq ORF | 870 |
| Synonyms | CD16; CD16A; FCG3; FCGR3; FCGRIII; FCR-10; FCRIII; FCRIIIA; IGFR3; IMD20 |
| Locus ID | 2214 |
| Cytogenetics | 1q23.3 |
| Summary | This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2020] |
| Protein Families | ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
| Protein Pathways | Fc gamma R-mediated phagocytosis, Natural killer cell mediated cytotoxicity, Systemic lupus erythematosus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400194 | FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426815 | FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426817 | FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400194 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 1 |
CNY 3,080.00 |
|
| LY426815 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 3 |
CNY 3,080.00 |
|
| LY426817 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 5 |
CNY 3,080.00 |
|
| TP306429 | Recombinant protein of human Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP721246 | Human CD16a Protein (C-His-Avi, 176V) |
CNY 2,450.00 |
|
| TP721247 | Biotinylated Human CD16a Protein (C-His-Avi, 176V) |
CNY 3,480.00 |
|
| TP721248 | PE Conjugated Human CD16a Protein (C-His, 176V) |
CNY 3,480.00 |
|
| TP721249 | APC Conjugated Human CD16a Protein (C-His, 176V) |
CNY 3,480.00 |
|
| TP723977 | Human FCGR3A Protein, His Tag |
CNY 4,925.00 |
|
| TP762433 | Purified recombinant protein of Human Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 3, Leu13-Gln208, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
