PHYH (NM_006214) Human Mass Spec Standard
CAT#: PH306277
PHYH MS Standard C13 and N15-labeled recombinant protein (NP_006205)
View other "PHYH" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PHYH MS Standard C13 and N15-labeled recombinant protein (NP_006205) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206277 |
Predicted MW | 38.5 kDa |
Protein Sequence |
>RC206277 protein sequence
Red=Cloning site Green=Tags(s) MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIK NLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEIL KYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLP GTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISC HFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006205 |
RefSeq Size | 1620 |
RefSeq ORF | 1014 |
Synonyms | LN1; LNAP1; PAHX; PHYH1; RD |
Locus ID | 5264 |
Cytogenetics | 10p13 |
Summary | This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have been associated with Refsum disease (RD) and deficient protein activity has been associated with Zellweger syndrome and rhizomelic chondrodysplasia punctata. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416793 | PHYH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421921 | PHYH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416793 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1 |
CNY 3,080.00 |
|
LY421921 | Transient overexpression lysate of phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 2 |
CNY 3,080.00 |
|
TP306277 | Recombinant protein of human phytanoyl-CoA 2-hydroxylase (PHYH), transcript variant 1, 20 µg |
CNY 2,900.00 |