HAAO (NM_012205) Human Mass Spec Standard
CAT#: PH306273
HAAO MS Standard C13 and N15-labeled recombinant protein (NP_036337)
View other "HAAO" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HAAO MS Standard C13 and N15-labeled recombinant protein (NP_036337) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206273 |
Predicted MW | 32.6 kDa |
Protein Sequence |
>RC206273 protein sequence
Red=Cloning site Green=Tags(s) MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQG KHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQ LAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQ VIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPA CKKPLG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036337 |
RefSeq Size | 1301 |
RefSeq ORF | 858 |
Synonyms | 3-HAO; h3HAO; HAO; VCRL1 |
Locus ID | 23498 |
Cytogenetics | 2p21 |
Summary | 3-Hydroxyanthranilate 3,4-dioxygenase is a monomeric cytosolic protein belonging to the family of intramolecular dioxygenases containing nonheme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is also present in low amounts in the central nervous system. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurologic and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Tryptophan metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415914 | HAAO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415914 | Transient overexpression lysate of 3-hydroxyanthranilate 3,4-dioxygenase (HAAO) |
CNY 3,080.00 |
|
TP306273 | Recombinant protein of human 3-hydroxyanthranilate 3,4-dioxygenase (HAAO), 20 µg |
CNY 2,900.00 |