SCRN1 (NM_014766) Human Mass Spec Standard
CAT#: PH306268
SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_055581)
View other "SCRN1" proteins (11)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_055581) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206268 |
Predicted MW | 46.4 kDa |
Protein Sequence |
>RC206268 protein sequence
Red=Cloning site Green=Tags(s) MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS VLPQNRSSPCIHYFTGTHDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055581 |
RefSeq Size | 5278 |
RefSeq ORF | 1242 |
Synonyms | SES1 |
Locus ID | 9805 |
Cytogenetics | 7p14.3 |
Summary | This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414994 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428918 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428919 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428920 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY414994 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY428918 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY428919 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 3 |
CN¥ 3,080.00 |
|
LY428920 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 4 |
CN¥ 3,080.00 |
|
PH327072 | SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138985) |
CN¥ 19,520.00 |
|
TP306268 | Recombinant protein of human secernin 1 (SCRN1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP327072 | Recombinant protein of human secernin 1 (SCRN1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |