EIF5A2 (NM_020390) Human Mass Spec Standard
CAT#: PH306249
EIF5A2 MS Standard C13 and N15-labeled recombinant protein (NP_065123)
View other "EIF5A2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | EIF5A2 MS Standard C13 and N15-labeled recombinant protein (NP_065123) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206249 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC206249 protein sequence
Red=Cloning site Green=Tags(s) MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE DICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCA MSEEYAVAIKPCK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065123 |
RefSeq Size | 5537 |
RefSeq ORF | 459 |
Synonyms | EIF-5A2; eIF5AII |
Locus ID | 56648 |
Cytogenetics | 3q26.2 |
Summary | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412495 | EIF5A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412495 | Transient overexpression lysate of eukaryotic translation initiation factor 5A2 (EIF5A2) |
CNY 3,080.00 |
|
TP306249 | Recombinant protein of human eukaryotic translation initiation factor 5A2 (EIF5A2), 20 µg |
CNY 2,900.00 |
|
TP721029 | Purified recombinant protein of Human eukaryotic translation initiation factor 5A2 (EIF5A2) |
CNY 3,140.00 |