EIF5A2 (NM_020390) Human Tagged ORF Clone
CAT#: RC206249
EIF5A2 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 5A2 (EIF5A2)
ORF Plasmid: tGFP
"NM_020390" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | EIF-5A2; eIF5AII |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC206249 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGACGAAATTGATTTCACTACTGGAGATGCCGGGGCTTCCAGCACTTACCCTATGCAGTGCTCGG CCTTGCGCAAAAACGGCTTCGTGGTGCTCAAAGGACGACCATGCAAAATAGTGGAGATGTCAACTTCCAA AACTGGAAAGCATGGTCATGCCAAGGTTCACCTTGTTGGAATTGATATTTTCACGGGCAAAAAATATGAA GATATTTGTCCTTCTACTCACAACATGGATGTTCCAAATATTAAGAGAAATGATTATCAACTGATATGCA TTCAAGATGGTTACCTTTCCCTGCTGACAGAAACTGGTGAAGTTCGTGAGGATCTTAAACTGCCAGAAGG TGAACTAGGCAAAGAAATAGAGGGAAAATACAATGCAGGTGAAGATGTACAGGTGTCTGTCATGTGTGCA ATGAGTGAAGAATATGCTGTAGCCATAAAACCCTGCAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206249 protein sequence
Red=Cloning site Green=Tags(s) MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE DICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCA MSEEYAVAIKPCK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_020390 |
ORF Size | 459 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_020390.6 |
RefSeq Size | 5537 bp |
RefSeq ORF | 462 bp |
Locus ID | 56648 |
UniProt ID | Q9GZV4 |
MW | 16.8 kDa |
Gene Summary | mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Laminin signals initiate the reciprocal loop that informs breast-specific gene expression and homeostasis by activating NO, p53 and microRNAs
,Furuta, S;Ren, G;Mao, JH;Bissell, MJ;,
Elife
,PubMed ID 29560860
[EIF5A2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC206249L1 | Lenti ORF clone of Human eukaryotic translation initiation factor 5A2 (EIF5A2), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC206249L2 | Lenti ORF clone of Human eukaryotic translation initiation factor 5A2 (EIF5A2), mGFP tagged |
CNY 4,200.00 |
|
RC206249L3 | Lenti ORF clone of Human eukaryotic translation initiation factor 5A2 (EIF5A2), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC206249L4 | Lenti ORF clone of Human eukaryotic translation initiation factor 5A2 (EIF5A2), mGFP tagged |
CNY 4,200.00 |
|
RG206249 | EIF5A2 (tGFP-tagged) - Human eukaryotic translation initiation factor 5A2 (EIF5A2) |
CNY 3,400.00 |
|
SC126117 | EIF5A2 (untagged)-Human eukaryotic translation initiation factor 5A2 (EIF5A2) |
CNY 1,200.00 |