COX6B2 (NM_144613) Human Mass Spec Standard
CAT#: PH306224
COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214)
View other "COX6B2" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | COX6B2 MS Standard C13 and N15-labeled recombinant protein (NP_653214) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206224 |
Predicted MW | 10.5 kDa |
Protein Sequence |
>RC206224 protein sequence
Red=Cloning site Green=Tags(s) MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPIS WVESWNEQIKNGIFAGKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_653214 |
RefSeq Size | 1679 |
RefSeq ORF | 264 |
Synonyms | COXVIB2; CT59 |
Locus ID | 125965 |
Cytogenetics | 19q13.42 |
Summary | Connects the two COX monomers into the physiological dimeric form.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408248 | COX6B2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY408248 | Transient overexpression lysate of cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2) |
CN¥ 3,080.00 |
|
TP306224 | Recombinant protein of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) (COX6B2), 20 µg |
CN¥ 2,900.00 |