ARF3 (NM_001659) Human Mass Spec Standard
CAT#: PH306192
ARF3 MS Standard C13 and N15-labeled recombinant protein (NP_001650)
View other "ARF3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ARF3 MS Standard C13 and N15-labeled recombinant protein (NP_001650) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206192 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC206192 protein sequence
Red=Cloning site Green=Tags(s) MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001650 |
RefSeq Size | 3556 |
RefSeq ORF | 543 |
Locus ID | 377 |
Cytogenetics | 12q13.12 |
Summary | ADP-ribosylation factor 3 (ARF3) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6) and members of each class share a common gene organization. The ARF3 gene contains five exons and four introns. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400626 | ARF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400626 | Transient overexpression lysate of ADP-ribosylation factor 3 (ARF3) |
CNY 3,080.00 |
|
TP306192 | Recombinant protein of human ADP-ribosylation factor 3 (ARF3), 20 µg |
CNY 2,900.00 |