TXNDC (TMX1) (NM_030755) Human Mass Spec Standard
CAT#: PH306187
TMX1 MS Standard C13 and N15-labeled recombinant protein (NP_110382)
View other "TXNDC" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TMX1 MS Standard C13 and N15-labeled recombinant protein (NP_110382) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206187 |
Predicted MW | 31.8 kDa |
Protein Sequence |
>RC206187 protein sequence
Red=Cloning site Green=Tags(s) MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFA EWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSS WFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSK RRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_110382 |
RefSeq Size | 4119 |
RefSeq ORF | 840 |
Synonyms | PDIA11; TMX; TXNDC; TXNDC1 |
Locus ID | 81542 |
Cytogenetics | 14q22.1 |
Summary | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410692 | TMX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410692 | Transient overexpression lysate of thioredoxin-related transmembrane protein 1 (TMX1) |
CNY 3,080.00 |
|
TP306187 | Recombinant protein of human thioredoxin-related transmembrane protein 1 (TMX1), 20 µg |
CNY 2,900.00 |