Cysteine Dioxygenase Type 1 (CDO1) (NM_001801) Human Mass Spec Standard
CAT#: PH306067
CDO1 MS Standard C13 and N15-labeled recombinant protein (NP_001792)
View other "Cysteine Dioxygenase Type 1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CDO1 MS Standard C13 and N15-labeled recombinant protein (NP_001792) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206067 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC206067 protein sequence
Red=Cloning site Green=Tags(s) MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLH RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001792 |
RefSeq Size | 1627 |
RefSeq ORF | 600 |
Synonyms | CDO-I |
Locus ID | 1036 |
Cytogenetics | 5q22.3 |
Summary | Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways, Taurine and hypotaurine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419737 | CDO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419737 | Transient overexpression lysate of cysteine dioxygenase, type I (CDO1) |
CNY 3,080.00 |
|
TP306067 | Recombinant protein of human cysteine dioxygenase, type I (CDO1), 20 µg |
CNY 2,900.00 |
|
TP720520 | Recombinant protein of human cysteine dioxygenase, type I (CDO1) |
CNY 3,140.00 |
其它Cysteine Dioxygenase Type 1产品