FATE1 (NM_033085) Human Mass Spec Standard
CAT#: PH305951
FATE1 MS Standard C13 and N15-labeled recombinant protein (NP_149076)
View other "FATE1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FATE1 MS Standard C13 and N15-labeled recombinant protein (NP_149076) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205951 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC205951 protein sequence
Red=Cloning site Green=Tags(s) MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_149076 |
RefSeq Size | 1071 |
RefSeq ORF | 549 |
Synonyms | CT43; FATE |
Locus ID | 89885 |
Cytogenetics | Xq28 |
Summary | This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli cells in seminiferous tubules. This protein may have a role in the control of early testicular differentiation and cell proliferation. [provided by RefSeq, Jan 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409735 | FATE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409735 | Transient overexpression lysate of fetal and adult testis expressed 1 (FATE1) |
CNY 3,080.00 |
|
TP305951 | Recombinant protein of human fetal and adult testis expressed 1 (FATE1), 20 µg |
CNY 2,900.00 |