HLAE (HLA-E) (NM_005516) Human Mass Spec Standard
CAT#: PH305939
HLA MS Standard C13 and N15-labeled recombinant protein (NP_005507)
View other "HLAE" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | HLA MS Standard C13 and N15-labeled recombinant protein (NP_005507) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205939 |
Predicted MW | 40.1 kDa |
Protein Sequence |
>RC205939 protein sequence
Red=Cloning site Green=Tags(s) MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRA PWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYD GKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHV THHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTC HVQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSA QGSESHSL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005507 |
RefSeq Size | 2679 |
RefSeq ORF | 1074 |
Synonyms | HLA-6.2; QA1 |
Locus ID | 3133 |
Cytogenetics | 6p22.1 |
Summary | HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Allograft rejection, Antigen processing and presentation, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Endocytosis, Graft-versus-host disease, Natural killer cell mediated cytotoxicity, Type I diabetes mellitus, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401693 | HLA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401693 | Transient overexpression lysate of major histocompatibility complex, class I, E (HLA-E) |
CN¥ 3,080.00 |
|
TP305939 | Recombinant protein of human major histocompatibility complex, class I, E (HLA-E), 20 µg |
CN¥ 2,900.00 |