MT1F (NM_005949) Human Mass Spec Standard
CAT#: PH305931
MT1F MS Standard C13 and N15-labeled recombinant protein (NP_005940)
View other "MT1F" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MT1F MS Standard C13 and N15-labeled recombinant protein (NP_005940) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205931 |
Predicted MW | 6.1 kDa |
Protein Sequence |
>RC205931 protein sequence
Red=Cloning site Green=Tags(s) MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005940 |
RefSeq Size | 456 |
RefSeq ORF | 183 |
Synonyms | MT1 |
Locus ID | 4494 |
Cytogenetics | 16q13 |
Summary | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416965 | MT1F HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416965 | Transient overexpression lysate of metallothionein 1F (MT1F) |
CNY 3,080.00 |
|
TP305931 | Recombinant protein of human metallothionein 1F (MT1F), 20 µg |
CNY 2,900.00 |