LSM7 (NM_016199) Human Mass Spec Standard
CAT#: PH305835
LSM7 MS Standard C13 and N15-labeled recombinant protein (NP_057283)
View other "LSM7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | LSM7 MS Standard C13 and N15-labeled recombinant protein (NP_057283) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205835 |
Predicted MW | 11.6 kDa |
Protein Sequence |
>RC205835 protein sequence
Red=Cloning site Green=Tags(s) MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQ LGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057283 |
RefSeq Size | 536 |
RefSeq ORF | 309 |
Synonyms | YNL147W |
Locus ID | 51690 |
Cytogenetics | 19p13.3 |
Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation, Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414131 | LSM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414131 | Transient overexpression lysate of LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM7) |
CNY 3,080.00 |
|
TP305835 | Recombinant protein of human LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM7), 20 µg |
CNY 2,900.00 |