CALML3 (NM_005185) Human Mass Spec Standard
CAT#: PH305791
CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176)
View other "CALML3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CALML3 MS Standard C13 and N15-labeled recombinant protein (NP_005176) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205791 |
Predicted MW | 16.9 kDa |
Protein Sequence |
>RC205791 protein sequence
Red=Cloning site Green=Tags(s) MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFL GMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYE EFVRVLVSK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005176 |
RefSeq Size | 1417 |
RefSeq ORF | 447 |
Synonyms | CLP |
Locus ID | 810 |
Cytogenetics | 10p15.1 |
Summary | May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417458 | CALML3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417458 | Transient overexpression lysate of calmodulin-like 3 (CALML3) |
CNY 3,080.00 |
|
TP305791 | Recombinant protein of human calmodulin-like 3 (CALML3), 20 µg |
CNY 2,900.00 |