Epithelial Stromal Interaction 1 (EPSTI1) (NM_001002264) Human Mass Spec Standard
CAT#: PH305699
EPSTI1 MS Standard C13 and N15-labeled recombinant protein (NP_001002264)
View other "Epithelial Stromal Interaction 1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EPSTI1 MS Standard C13 and N15-labeled recombinant protein (NP_001002264) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205699 |
Predicted MW | 47.5 kDa |
Protein Sequence |
>RC205699 protein sequence
Red=Cloning site Green=Tags(s) MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLI APNINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREE SVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSA VCGPQSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTE HRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSWGSLLVFSRHLRVYEKILTPIWPSSTDLEKPHEML FLNVILFSLTVFTLISTAHTLDRAVRSDWLLLVLIYACLEELIPELIFNLYCQGNATLFF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001002264 |
RefSeq Size | 3201 |
RefSeq ORF | 1230 |
Synonyms | BRESI1 |
Locus ID | 94240 |
Cytogenetics | 13q14.11 |
Summary | The protein encoded by this gene has been shown to promote tumor invasion and metastasis in some invasive cancer cells when overexpressed. Expression of this gene has been shown to be upregulated by direct binding of the Kruppel like factor 8 protein to promoter sequences. The translated protein interacts with the amino terminal region of the valosin containing protein gene product, resulting in the nuclear translocation of the nuclear factor kappa B subunit 1 gene product, and activation of target genes. Overexpression of this gene has been observed in some breast cancers and in some individuals with systemic lupus erythematosus (SLE). [provided by RefSeq, Sep 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409659 | EPSTI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424196 | EPSTI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409659 | Transient overexpression lysate of epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 2 |
CNY 3,080.00 |
|
LY424196 | Transient overexpression lysate of epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 1 |
CNY 3,080.00 |
|
PH317229 | EPSTI1 MS Standard C13 and N15-labeled recombinant protein (NP_150280) |
CNY 19,520.00 |
|
TP305699 | Recombinant protein of human epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317229 | Recombinant protein of human epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Epithelial Stromal Interaction 1产品