United States
Germany
Japan
United Kingdom
China
CAMK2B (NM_172081) Human Mass Spec Standard
CAT＃: PH305669
CAMK2B MS Standard C13 and N15-labeled recombinant protein (NP_742078)
View other "CAMK2B" proteins (21)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | CAMK2B MS Standard C13 and N15-labeled recombinant protein (NP_742078) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205669 |
| Predicted MW | 56.4 kDa |
| Protein Sequence |
>RC205669 protein sequence
Red=Cloning site Green=Tags(s) MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKH SNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPE NLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGVILYILLVG YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVAS MMHRQETVECLKKFNARRKLKGAILTTMLATRNFSAAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPP AALESSDSANTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFH RFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNV HFHCSGAPVAPLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_742078 |
| RefSeq Size | 4097 |
| RefSeq ORF | 1509 |
| Synonyms | CAM2; CAMK2; CAMKB; CaMKIIbeta; MRD54 |
| Locus ID | 816 |
| Cytogenetics | 7p13 |
| Summary | The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Calcium signaling pathway, ErbB signaling pathway, Glioma, GnRH signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406822 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC406823 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC406824 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC406825 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406826 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC406827 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC406828 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420062 | CAMK2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY406822 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2 |
CNY 4,840.00 |
|
| LY406823 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 3 |
CNY 4,840.00 |
|
| LY406824 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 4 |
CNY 4,840.00 |
|
| LY406825 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5 |
CNY 3,080.00 |
|
| LY406826 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 6 |
CNY 4,840.00 |
|
| LY406827 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 7 |
CNY 4,840.00 |
|
| LY406828 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 8 |
CNY 4,840.00 |
|
| LY420062 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 1 |
CNY 4,840.00 |
|
| TP305669 | Recombinant protein of human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP720912 | Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 5 |
CNY 1,800.00 |
|
| TP762573 | Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CNY 2,480.00 |
|
| TP762608 | Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CNY 2,480.00 |
|
| TP762620 | Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase II beta (CAMK2B), transcript variant 6, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug |
CNY 2,480.00 |
