Non Neuronal Enolase (ENO1) (NM_001428) Human Mass Spec Standard
CAT#: PH305494
ENO1 MS Standard C13 and N15-labeled recombinant protein (NP_001419)
View other "Non Neuronal Enolase" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ENO1 MS Standard C13 and N15-labeled recombinant protein (NP_001419) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205494 |
Predicted MW | 47.2 kDa |
Protein Sequence |
>RC205494 protein sequence
Red=Cloning site Green=Tags(s) MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHIN KTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGN SEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDE GGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLY KSFIKDYPVVSIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSV TESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSK AKFAGRNFRNPLAK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001419 |
RefSeq Size | 2204 |
RefSeq ORF | 1302 |
Synonyms | ENO1L1; HEL-S-17; MPB1; NNE; PPH |
Locus ID | 2023 |
Cytogenetics | 1p36.23 |
Summary | This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400561 | ENO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400561 | Transient overexpression lysate of enolase 1, (alpha) (ENO1) |
CNY 3,080.00 |
|
TP305494 | Recombinant protein of human enolase 1, (alpha) (ENO1), 20 µg |
CNY 2,900.00 |
|
TP762494 | Purified recombinant protein of Human enolase 1, (alpha) (ENO1), transcript variant 1, 1Met-421Ala, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2,150.00 |
其它Non Neuronal Enolase产品