Aquaporin 1 (AQP1) (NM_198098) Human Mass Spec Standard
CAT#: PH305304
AQP1 MS Standard C13 and N15-labeled recombinant protein (NP_932766)
View other "Aquaporin 1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | AQP1 MS Standard C13 and N15-labeled recombinant protein (NP_932766) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205304 |
Predicted MW | 28.6 kDa |
Protein Sequence |
>RC205304 protein sequence
Red=Cloning site Green=Tags(s) MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTTVQDNVKVSLAFGLSIATLAQSVGHI SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_932766 |
RefSeq Size | 2807 |
RefSeq ORF | 807 |
Synonyms | AQP-CHIP; CHIP28; CO |
Locus ID | 358 |
Cytogenetics | 7p14.3 |
Summary | This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403670 | AQP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403670 | Transient overexpression lysate of aquaporin 1 (Colton blood group) (AQP1) |
CNY 3,080.00 |
|
TP305304 | Recombinant protein of human aquaporin 1 (Colton blood group) (AQP1), 20 µg |
CNY 2,900.00 |
|
TP329599 | Purified recombinant protein of Homo sapiens aquaporin 1 (Colton blood group) (AQP1), transcript variant 4, 20 µg |
CNY 2,900.00 |
其它Aquaporin 1产品