United States
Germany
Japan
United Kingdom
China
CD83 (NM_004233) Human Mass Spec Standard
CAT＃: PH305302
CD83 MS Standard C13 and N15-labeled recombinant protein (NP_004224)
View other "CD83" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CD83 MS Standard C13 and N15-labeled recombinant protein (NP_004224) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205302 |
| Predicted MW | 23 kDa |
| Protein Sequence |
>RC205302 protein sequence
Red=Cloning site Green=Tags(s) MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRG QHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKK YRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004224 |
| RefSeq Size | 2478 |
| RefSeq ORF | 615 |
| Synonyms | BL11; HB15 |
| Locus ID | 9308 |
| Cytogenetics | 6p23 |
| Summary | The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401360 | CD83 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421736 | CD83 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401360 | Transient overexpression lysate of CD83 molecule (CD83), transcript variant 1 |
CNY 3,080.00 |
|
| LY421736 | Transient overexpression lysate of CD83 molecule (CD83), transcript variant 2 |
CNY 3,080.00 |
|
| PH312520 | CD83 MS Standard C13 and N15-labeled recombinant protein (NP_001035370) |
CNY 19,520.00 |
|
| TP305302 | Recombinant protein of human CD83 molecule (CD83), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP312520 | Recombinant protein of human CD83 molecule (CD83), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720345 | Recombinant protein of human CD83 molecule (CD83), transcript variant 2 |
CNY 3,140.00 |
