G protein alpha inhibitor 1 (GNAI1) (NM_002069) Human Mass Spec Standard
CAT#: PH305289
GNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_002060)
View other "G protein alpha inhibitor 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_002060) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205289 |
Predicted MW | 40.2 kDa |
Protein Sequence |
>RC205289 representing NM_002069
Red=Cloning site Green=Tags(s) MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYK AVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACF NRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKK WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKK SPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD CGLF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002060 |
RefSeq Size | 3342 |
RefSeq ORF | 1062 |
Synonyms | Gi |
Locus ID | 2770 |
Cytogenetics | 7q21.11 |
Summary | Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The alpha subunit binds guanine nucleotide, can hydrolyze GTP, and can interact with other proteins. The protein encoded by this gene represents the alpha subunit of an inhibitory complex. The encoded protein is part of a complex that responds to beta-adrenergic signals by inhibiting adenylate cyclase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, Chemokine signaling pathway, Gap junction, Leukocyte transendothelial migration, Long-term depression, Melanogenesis, Progesterone-mediated oocyte maturation, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419561 | GNAI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419561 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1) |
CNY 3,080.00 |
|
TP305289 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 (GNAI1), 20 µg |
CNY 2,900.00 |
其它G protein alpha inhibitor 1产品