WIF1 (NM_007191) Human Mass Spec Standard
CAT#: PH305256
WIF1 MS Standard C13 and N15-labeled recombinant protein (NP_009122)
View other "WIF1" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | WIF1 MS Standard C13 and N15-labeled recombinant protein (NP_009122) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205256 |
Predicted MW | 41.5 kDa |
Protein Sequence |
>RC205256 protein sequence
Red=Cloning site Green=Tags(s) MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDF RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPC LGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE KALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQ PCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALR PAGAQLRQHTPSLKKAEERRDPPESNYIW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009122 |
RefSeq Size | 2240 |
RefSeq ORF | 1137 |
Synonyms | WIF-1 |
Locus ID | 11197 |
Cytogenetics | 12q14.3 |
Summary | The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation. This gene functions as a tumor suppressor gene, and has been found to be epigenetically silenced in various cancers. [provided by RefSeq, Jun 2010] |
Protein Families | Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway |
Protein Pathways | Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402102 | WIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402102 | Transient overexpression lysate of WNT inhibitory factor 1 (WIF1) |
CN¥ 3,080.00 |
|
TP305256 | Recombinant protein of human WNT inhibitory factor 1 (WIF1), 20 µg |
CN¥ 2,900.00 |
|
TP720656 | Purified recombinant protein of Human WNT inhibitory factor 1 (WIF1) |
CN¥ 1,800.00 |