Cbl c (CBLC) (NM_012116) Human Mass Spec Standard
CAT#: PH305130
CBLC MS Standard C13 and N15-labeled recombinant protein (NP_036248)
View other "Cbl c" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CBLC MS Standard C13 and N15-labeled recombinant protein (NP_036248) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205130 |
Predicted MW | 52.5 kDa |
Protein Sequence |
>RC205130 protein sequence
Red=Cloning site Green=Tags(s) MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGP GGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQLAKLAIIFSHMHAELHALFP GGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFE FDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSS DGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFEL CKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDPGNSSDQE GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036248 |
RefSeq Size | 1591 |
RefSeq ORF | 1422 |
Synonyms | CBL-3; CBL-SL; RNF57 |
Locus ID | 23624 |
Cytogenetics | 19q13.32 |
Summary | This gene encodes a member of the Cbl family of E3 ubiquitin ligases. Cbl proteins play important roles in cell signaling through the ubiquitination and subsequent downregulation of tyrosine kinases. Expression of this gene may be restricted to epithelial cells, and alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Chronic myeloid leukemia, Endocytosis, ErbB signaling pathway, Insulin signaling pathway, Jak-STAT signaling pathway, Pathways in cancer, T cell receptor signaling pathway, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402148 | CBLC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427289 | CBLC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402148 | Transient overexpression lysate of Cas-Br-M (murine) ecotropic retroviral transforming sequence c (CBLC), transcript variant 1 |
CNY 3,080.00 |
|
LY427289 | Transient overexpression lysate of Cas-Br-M (murine) ecotropic retroviral transforming sequence c (CBLC), transcript variant 2 |
CNY 3,080.00 |
|
TP305130 | Recombinant protein of human Cas-Br-M (murine) ecotropic retroviral transforming sequence c (CBLC), transcript variant 1, 20 µg |
CNY 2,900.00 |