SNRPG (NM_003096) Human Mass Spec Standard
CAT#: PH305113
SNRPG MS Standard C13 and N15-labeled recombinant protein (NP_003087)
View other "SNRPG" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNRPG MS Standard C13 and N15-labeled recombinant protein (NP_003087) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205113 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC205113 protein sequence
Red=Cloning site Green=Tags(s) MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML EALERV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003087 |
RefSeq Size | 606 |
RefSeq ORF | 228 |
Synonyms | Sm-G; SMG |
Locus ID | 6637 |
Cytogenetics | 2p13.3 |
Summary | The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401078 | SNRPG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401078 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide G (SNRPG) |
CNY 3,080.00 |
|
TP305113 | Recombinant protein of human small nuclear ribonucleoprotein polypeptide G (SNRPG), 20 µg |
CNY 2,900.00 |