SHMT1 (NM_148918) Human Mass Spec Standard
CAT#: PH305102
SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_683718)
View other "SHMT1" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_683718) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205102 |
Predicted MW | 49 kDa |
Protein Sequence |
>RC205102 protein sequence
Red=Cloning site Green=Tags(s) MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLN NKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMG LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLE YARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVAVALKQA MTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTC PGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQA AVQALREEVESFASLFPLPGLPDF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_683718 |
RefSeq Size | 2436 |
RefSeq ORF | 1332 |
Synonyms | CSHMT; SHMT |
Locus ID | 6470 |
Cytogenetics | 17p11.2 |
Summary | This gene encodes the cytosolic form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one-carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. A pseudogene of this gene is located on the short arm of chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Pathways | Cyanoamino acid metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, Methane metabolism, One carbon pool by folate |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401341 | SHMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407729 | SHMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401341 | Transient overexpression lysate of serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY407729 | Transient overexpression lysate of serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 2 |
CN¥ 3,080.00 |
|
PH303461 | SHMT1 MS Standard C13 and N15-labeled recombinant protein (NP_004160) |
CN¥ 19,520.00 |
|
TP303461 | Recombinant protein of human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP305102 | Recombinant protein of human serine hydroxymethyltransferase 1 (soluble) (SHMT1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |