Peroxiredoxin 3 (PRDX3) (NM_006793) Human Mass Spec Standard
CAT#: PH305080
PRDX3 MS Standard C13 and N15-labeled recombinant protein (NP_006784)
View other "Peroxiredoxin 3" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PRDX3 MS Standard C13 and N15-labeled recombinant protein (NP_006784) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205080 |
Predicted MW | 27.7 kDa |
Protein Sequence |
>RC205080 protein sequence
Red=Cloning site Green=Tags(s) MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAP YFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSH LAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVE ETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006784 |
RefSeq Size | 1641 |
RefSeq ORF | 768 |
Synonyms | AOP-1; AOP1; HBC189; MER5; PRO1748; prx-III; SP-22 |
Locus ID | 10935 |
Cytogenetics | 10q26.11 |
Summary | This gene encodes a mitochondrial protein with antioxidant function. The protein is similar to the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase, and it can rescue bacterial resistance to alkylhydroperoxide in E. coli that lack the C22 subunit. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologs suggest that these genes consist of a family that is responsible for the regulation of cellular proliferation, differentiation and antioxidant functions. This family member can protect cells from oxidative stress, and it can promote cell survival in prostate cancer. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1, 3, 13 and 22. [provided by RefSeq, Oct 2014] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415481 | PRDX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416417 | PRDX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415481 | Transient overexpression lysate of peroxiredoxin 3 (PRDX3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY416417 | Transient overexpression lysate of peroxiredoxin 3 (PRDX3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
TP305080 | Recombinant protein of human peroxiredoxin 3 (PRDX3), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720965 | Purified recombinant protein of Human peroxiredoxin 3 (PRDX3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,140.00 |
其它Peroxiredoxin 3产品