UPRT (NM_145052) Human Mass Spec Standard
CAT#: PH305030
UPRT MS Standard C13 and N15-labeled recombinant protein (NP_659489)
View other "UPRT" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | UPRT MS Standard C13 and N15-labeled recombinant protein (NP_659489) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205030 |
Predicted MW | 33.8 kDa |
Protein Sequence |
>RC205030 protein sequence
Red=Cloning site Green=Tags(s) MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACG GSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA DRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQ SDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSII QEFPEITILTTEVHPVAPTHFGQKYFGTD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_659489 |
RefSeq Size | 2512 |
RefSeq ORF | 927 |
Synonyms | FUR1; UPP |
Locus ID | 139596 |
Cytogenetics | Xq13.3 |
Summary | This gene encodes uracil phosphoribosyltransferase, which catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP). This reaction is an important part of nucleotide metabolism, specifically the pyrimidine salvage pathway. The enzyme localizes to the nucleus and cytoplasm. The protein is a potential target for rational design of drugs to treat parasitic infections and cancer. [provided by RefSeq, Nov 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408068 | UPRT HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY408068 | Transient overexpression lysate of uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), transcript variant 1 |
CN¥ 3,080.00 |
|
TP305030 | Recombinant protein of human uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), 20 µg |
CN¥ 2,900.00 |
|
TP721007 | Purified recombinant protein of Human uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae) (UPRT), transcript variant 1 |
CN¥ 1,800.00 |