ATP5PO (NM_001697) Human Mass Spec Standard
CAT#: PH304991
ATP5O MS Standard C13 and N15-labeled recombinant protein (NP_001688)
View other "ATP5PO" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ATP5O MS Standard C13 and N15-labeled recombinant protein (NP_001688) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204991 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC204991 protein sequence
Red=Cloning site Green=Tags(s) MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR EIV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001688 |
RefSeq Size | 815 |
RefSeq ORF | 639 |
Synonyms | ATP5O; ATPO; HMC08D05; OSCP |
Locus ID | 539 |
Cytogenetics | 21q22.11 |
Summary | The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419797 | ATP5O HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419797 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP304991 | Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |