Deoxyguanosine kinase (DGUOK) (NM_080916) Human Mass Spec Standard
CAT#: PH304891
DGUOK MS Standard C13 and N15-labeled recombinant protein (NP_550438)
View other "Deoxyguanosine kinase" proteins (6)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | DGUOK MS Standard C13 and N15-labeled recombinant protein (NP_550438) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204891 |
Predicted MW | 32.1 kDa |
Protein Sequence |
>RC204891 protein sequence
Red=Cloning site Green=Tags(s) MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATE PVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIF ERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLHGFIYLQASPQVCLKRLYQRAREE EKGIELAYLEQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_550438 |
RefSeq Size | 1161 |
RefSeq ORF | 831 |
Synonyms | dGK; MTDPS3; NCPH; PEOB4 |
Locus ID | 1716 |
Cytogenetics | 2p13.1 |
Summary | In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409002 | DGUOK HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC409003 | DGUOK HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY409002 | Transient overexpression lysate of deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CN¥ 3,080.00 |
|
LY409003 | Transient overexpression lysate of deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CN¥ 3,080.00 |
|
TP304891 | Recombinant protein of human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP760996 | Purified recombinant protein of Human deoxyguanosine kinase (DGUOK), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CN¥ 2,040.00 |
其它Deoxyguanosine kinase产品