Frataxin (FXN) (NM_000144) Human Mass Spec Standard
CAT#: PH304880
FXN MS Standard C13 and N15-labeled recombinant protein (NP_000135)
View other "Frataxin" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | FXN MS Standard C13 and N15-labeled recombinant protein (NP_000135) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204880 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC204880 protein sequence
Red=Cloning site Green=Tags(s) MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKK QSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000135 |
RefSeq Size | 7168 |
RefSeq ORF | 630 |
Synonyms | CyaY; FA; FARR; FRDA; X25 |
Locus ID | 2395 |
Cytogenetics | 9q21.11 |
Summary | This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400054 | FXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431136 | FXN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400054 | Transient overexpression lysate of frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY431136 | Transient overexpression lysate of frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
TP304880 | Recombinant protein of human frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Frataxin产品