XPA (NM_000380) Human Mass Spec Standard
CAT#: PH304872
XPA MS Standard C13 and N15-labeled recombinant protein (NP_000371)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | XPA MS Standard C13 and N15-labeled recombinant protein (NP_000371) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204872 |
Predicted MW | 31.4 kDa |
Protein Sequence |
>RC204872 protein sequence
Red=Cloning site Green=Tags(s) MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIID TGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLIT KTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQEN REKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000371 |
RefSeq Size | 1491 |
RefSeq ORF | 819 |
Synonyms | XP1; XPAC |
Locus ID | 7507 |
Cytogenetics | 9q22.33 |
Summary | This gene encodes a zinc finger protein plays a central role in nucleotide excision repair (NER), a specialized type of DNA repair. NER is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens and chemotherapeutic drugs. The encoded protein interacts with DNA and several NER proteins, acting as a scaffold to assemble the NER incision complex at sites of DNA damage. Mutations in this gene cause Xeroderma pigmentosum complementation group A (XP-A), an autosomal recessive skin disorder featuring hypersensitivity to sunlight and increased risk for skin cancer. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424749 | XPA HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424749 | Transient overexpression lysate of xeroderma pigmentosum, complementation group A (XPA), transcript variant 1 |
CN¥ 3,080.00 |
|
TP304872 | Purified recombinant protein of Human xeroderma pigmentosum, complementation group A (XPA), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg |
CN¥ 2,900.00 |
|
TP762531 | Purified recombinant protein of Human xeroderma pigmentosum, complementation group A (XPA), transcript variant 1, 50ug |
CN¥ 2,480.00 |