PSGR (OR51E2) (NM_030774) Human Mass Spec Standard
CAT#: PH304752
OR51E2 MS Standard C13 and N15-labeled recombinant protein (NP_110401)
View other "PSGR" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | OR51E2 MS Standard C13 and N15-labeled recombinant protein (NP_110401) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204752 |
Predicted MW | 35.5 kDa |
Protein Sequence |
>RC204752 protein sequence
Red=Cloning site Green=Tags(s) MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYLFLCMLAAIDL ALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFDRYVAICHPLRHAAVLNNTVT AQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVHQDVMKLAYADTLPNVVYGLTAILLVMGVDV MFISLSYFLIIRTVLQLPSKSERAKAFGTCVSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYL LLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_110401 |
RefSeq Size | 2785 |
RefSeq ORF | 960 |
Synonyms | HPRAJ; OR51E3P; OR52A2; PSGR |
Locus ID | 81285 |
Cytogenetics | 11p15.4 |
Summary | Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Olfactory transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403077 | OR51E2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403077 | Transient overexpression lysate of olfactory receptor, family 51, subfamily E, member 2 (OR51E2) |
CNY 3,080.00 |
|
TP304752 | Recombinant protein of human olfactory receptor, family 51, subfamily E, member 2 (OR51E2), 20 µg |
CNY 2,900.00 |