Hemoglobin subunit gamma 2 (HBG2) (NM_000184) Human Mass Spec Standard
CAT#: PH304709
HBG2 MS Standard C13 and N15-labeled recombinant protein (NP_000175)
View other "Hemoglobin subunit gamma 2" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | HBG2 MS Standard C13 and N15-labeled recombinant protein (NP_000175) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204709 |
Predicted MW | 16.1 kDa |
Protein Sequence |
>RC204709 protein sequence
Red=Cloning site Green=Tags(s) MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLT SLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVAS ALSSRYH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000175 |
RefSeq Size | 583 |
RefSeq ORF | 441 |
Synonyms | HBG-T1; TNCY |
Locus ID | 3048 |
Cytogenetics | 11p15.4 |
Summary | The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424880 | HBG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424880 | Transient overexpression lysate of hemoglobin, gamma G (HBG2) |
CN¥ 3,080.00 |
|
TP304709 | Recombinant protein of human hemoglobin, gamma G (HBG2), 20 µg |
CN¥ 2,900.00 |
|
TP762675 | Purified recombinant protein of Human hemoglobin, gamma G (HBG2), 2Gly-End, with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 2,480.00 |
其它Hemoglobin subunit gamma 2产品