SLPI (NM_003064) Human Mass Spec Standard
CAT#: PH304697
SLPI MS Standard C13 and N15-labeled recombinant protein (NP_003055)
View other "SLPI" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SLPI MS Standard C13 and N15-labeled recombinant protein (NP_003055) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204697 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC204697 protein sequence
Red=Cloning site Green=Tags(s) MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGI KCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003055 |
RefSeq Size | 625 |
RefSeq ORF | 396 |
Synonyms | ALK1; ALP; BLPI; HUSI; HUSI-I; MPI; WAP4; WFDC4 |
Locus ID | 6590 |
Cytogenetics | 20q13.12 |
Summary | This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418925 | SLPI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418925 | Transient overexpression lysate of secretory leukocyte peptidase inhibitor (SLPI) |
CNY 3,080.00 |
|
TP304697 | Recombinant protein of human secretory leukocyte peptidase inhibitor (SLPI), 20 µg |
CNY 2,900.00 |