MD2 (LY96) (NM_015364) Human Mass Spec Standard
CAT#: PH304686
LY96 MS Standard C13 and N15-labeled recombinant protein (NP_056179)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LY96 MS Standard C13 and N15-labeled recombinant protein (NP_056179) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204686 |
Predicted MW | 18.4 kDa |
Protein Sequence |
>RC204686 protein sequence
Red=Cloning site Green=Tags(s) MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRD LKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISG SPEEMLFCLEFVILHQPNSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056179 |
RefSeq Size | 642 |
RefSeq ORF | 480 |
Synonyms | ESOP-1; ly-96; MD-2; MD2 |
Locus ID | 23643 |
Cytogenetics | 8q21.11 |
Summary | This gene encodes a protein which associates with toll-like receptor 4 on the cell surface and confers responsiveness to lipopolysaccyaride (LPS), thus providing a link between the receptor and LPS signaling. Studies of the mouse ortholog suggest that this gene may be involved in endotoxin neutralization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2010] |
Protein Families | Secreted Protein |
Protein Pathways | Pathogenic Escherichia coli infection, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414593 | LY96 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414593 | Transient overexpression lysate of lymphocyte antigen 96 (LY96) |
CNY 3,080.00 |
|
TP304686 | Recombinant protein of human lymphocyte antigen 96 (LY96), 20 µg |
CNY 2,900.00 |
|
TP330968 | Purified recombinant protein of Homo sapiens lymphocyte antigen 96 (LY96), transcript variant 2, 20 µg |
CNY 2,900.00 |