UBE1C (UBA3) (NM_003968) Human Mass Spec Standard
CAT#: PH304675
UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_003959)
View other "UBE1C" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_003959) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204675 |
Predicted MW | 51.7 kDa |
Protein Sequence |
>RC204675 representing NM_003968
Red=Cloning site Green=Tags(s) MADGEEPERKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTC KVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCN VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNA RVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQWPKEQPFGEGVPLDGDDPEHIQW IFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003959 |
RefSeq Size | 2136 |
RefSeq ORF | 1389 |
Synonyms | hUBA3; NAE2; UBE1C |
Locus ID | 9039 |
Cytogenetics | 3p14.1 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404973 | UBA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC418315 | UBA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404973 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2 |
CNY 4,840.00 |
|
LY418315 | Transient overexpression lysate of ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1 |
CNY 3,080.00 |
|
PH316801 | UBA3 MS Standard C13 and N15-labeled recombinant protein (NP_937838) |
CNY 19,520.00 |
|
TP304675 | Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP316801 | Recombinant protein of human ubiquitin-like modifier activating enzyme 3 (UBA3), transcript variant 2, 20 µg |
CNY 2,900.00 |