SMAD2 (NM_005901) Human Mass Spec Standard
CAT#: PH304604
SMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_005892)
View other "SMAD2" proteins (9)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | SMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_005892) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204604 |
Predicted MW | 52.1 kDa |
Protein Sequence |
>RC204604 representing NM_005901
Red=Cloning site Green=Tags(s) MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNC NTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH HELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI EPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY ELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECL SDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005892 |
RefSeq Size | 5415 |
RefSeq ORF | 1401 |
Synonyms | hMAD-2; hSMAD2; JV18; JV18-1; MADH2; MADR2 |
Locus ID | 4087 |
Cytogenetics | 18q21.1 |
Summary | The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2012] |
Protein Families | Cancer stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Protein Pathways | Adherens junction, Cell cycle, Colorectal cancer, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway, Wnt signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
M10, a Caspase Cleavage Product of the Hepatocyte Growth Factor Receptor, Interacts with Smad2 and Demonstrates Anti-Fibrotic Properties in Vitro and in Vivo
,null,
Translational research : the journal of laboratory and clinical medicine
,PubMed ID 26772959
[SMAD2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400372 | SMAD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC401783 | SMAD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC427736 | SMAD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400372 | Transient overexpression lysate of SMAD family member 2 (SMAD2), transcript variant 2 |
CN¥ 3,080.00 |
|
LY401783 | Transient overexpression lysate of SMAD family member 2 (SMAD2), transcript variant 1 |
CN¥ 3,080.00 |
|
LY427736 | Transient overexpression lysate of SMAD family member 2 (SMAD2), transcript variant 3 |
CN¥ 3,080.00 |
|
PH306526 | SMAD2 MS Standard C13 and N15-labeled recombinant protein (NP_001003652) |
CN¥ 19,520.00 |
|
TP304604 | Recombinant protein of human SMAD family member 2 (SMAD2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP306526 | Recombinant protein of human SMAD family member 2 (SMAD2), transcript variant 2, 20 µg |
CN¥ 2,900.00 |