AP2 alpha (TFAP2A) (NM_001032280) Human Mass Spec Standard
CAT#: PH304603
TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451)
View other "AP2 alpha" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TFAP2A MS Standard C13 and N15-labeled recombinant protein (NP_001027451) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204603 |
Predicted MW | 47.2 kDa |
Protein Sequence |
>RC204603 protein sequence
Red=Cloning site Green=Tags(s) MLVHSFSAMDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHV NDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGD LSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPG RLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANV TLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDR SPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNA KSSDKEEKHRK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001027451 |
RefSeq Size | 3808 |
RefSeq ORF | 1293 |
Synonyms | AP-2; AP-2alpha; AP2TF; BOFS; TFAP2 |
Locus ID | 7020 |
Cytogenetics | 6p24.3 |
Summary | The protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420895 | TFAP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422292 | TFAP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420895 | Transient overexpression lysate of transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 3 |
CNY 4,840.00 |
|
LY422292 | Transient overexpression lysate of transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 2 |
CNY 3,080.00 |
|
TP304603 | Recombinant protein of human transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它AP2 alpha产品